PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00894.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 299aa    MW: 33917.8 Da    PI: 8.6151
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00894.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-091531872155
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              k +yp+++++  LA+++gL+++q+ +WF N+R ++
  Rsa1.0_00894.1_g00018.1 153 KWPYPTEADKIALAEETGLDQKQINNWFINQRKRH 187
                              569*****************************885 PP

2ELK34.83.6e-12107128122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELK+qLlrK++++++sLk EFs
  Rsa1.0_00894.1_g00018.1 107 ELKDQLLRKFGSHISSLKLEFS 128
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.109107127IPR005539ELK domain
SMARTSM011881.1E-6107128IPR005539ELK domain
PfamPF037893.6E-9107128IPR005539ELK domain
PROSITE profilePS5007112.876127190IPR001356Homeobox domain
SuperFamilySSF466895.56E-20128201IPR009057Homeodomain-like
SMARTSM003898.1E-14129194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-28132191IPR009057Homeodomain-like
CDDcd000867.11E-13136191No hitNo description
PfamPF059206.8E-18147186IPR008422Homeobox KN domain
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTNASIFFMS FLRCALSGPC YFLVSSYLLG IFVVNALMFM NQIRLIVAAT LSVIEALFPG  60
VISIPQRLRK ANRCRDSDDG AVSSDEELRE GDDVATQDSQ QRSNDRELKD QLLRKFGSHI  120
SSLKLEFSKK KKKGKLPREA RQALLDWWNV HYKWPYPTEA DKIALAEETG LDQKQINNWF  180
INQRKRHWKP SENMPFAMMD DSSLDFVNEN ESIKALVLKI FIDEKALWPR AAATKQPNEN  240
LPFLVSNGPC GQVAVDGPWT PTRFRTHLNA QEKESIRGLA TPPGVRSGFN SDPDLTLLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX813531e-140X81353.1 A.thaliana mRNA for ATK1 protein.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.15e-70KNOTTED-like from Arabidopsis thaliana 2